Produse anticorp anti-NHS

Anticorpii anti-NHS sunt oferiți de un număr de furnizori. Această genă țintă codifică proteina „regulator de remodelare a actinei NHS” la om și poate fi cunoscută și sub denumirea de CTRCT40, CXN, SCML1, proteina sindromului Nance-Horan și sindromul Nance-Horan (cataracta congenitală și anomalii dentare). Structural, proteina este raportată a avea o masă de 179,1 kilodaltoni. Pe baza denumirii genei, pot fi găsiți, de asemenea, ortologi canini, porcini, maimuțe, șoareci și șobolani.

Descrierea proteinei de legare a ADN-ului H-NS (hns)

Numele produsului Proteina de legare a ADN-ului H-NS (hns)
ID-ul Uniprot P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Sistem de expresie Expresie procariotică
Secvenţă MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKDDFL
Greutate moleculară 17,63kDa
Puritate estimată 40% prin SDS-PAGE
Tampon 20 mM Tris HCI, pH 8,0, 2 mM MgCl2 și 20 mM NaCI
Conditii de livrare Gheață albastră (+ 4 °)
Termen de livrare în zile lucrătoare Europa: 5-7 zile lucrătoare
SUA și Canada: 7-10 zile lucrătoare
Restul lumii: 5-12 zile lucrătoare
Starea de depozitare 4 ° C pe termen scurt (1 săptămână), -20 ° C sau -80 ° C pe termen lung (evita ciclurile de îngheț / decongelare; adăugarea de 20-40% glicerol îmbunătățește crioprotecția)
Marca ProteoGenix
Specii gazdă Escherichia coli (E.coli)
Tipul fragmentului Met12-Gln156
Aliasuri / Sinonime Proteina de legare a ADN-ului H-NS, proteina asemănătoare histonei HLP-II, Proteina B1, Proteina H1
Referinţă PX-P4380
Notă Doar pentru cercetare

Profiluri de legare diferențiale ale StpA în  celule mutante de tip sălbatic și  hns : o analiză comparativă a partenerilor cooperativi prin analiza imunoprecipitării-microarray a cromatinei

ABSTRACT

Am efectuat analize de imunoprecipitare a cromatinei-microarray pentru a investiga diferențele în funcție între StpA și H-NS în   celulele Escherichia coli . Regiunile de legare StpA se suprapun în esență cu cele ale H-NS în celulele de tip sălbatic, în timp ce acestea sunt reduse la o treime în   mutantul hns .

anti- Antibody^Polyclonal antibody control antibody

LSMab09882 100 ug
EUR 525.6

ARHGDIA Antibody / RHOGDI Antibody

F54788-0.08ML 0.08 ml
EUR 165

ARHGDIA Antibody / RHOGDI Antibody

F54788-0.4ML 0.4 ml
EUR 379

Antibody

A1360-500 Ask for price

Ly1 Antibody Reactive (LYAR) Antibody

20-abx123734
  • EUR 493.20
  • EUR 710.40
  • 100 ul
  • 200 ul

Anti-Glycolipid Antibody (AGA) Antibody

20-abx004855
  • EUR 493.20
  • EUR 710.40
  • EUR 218.40
  • EUR 376.80
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Ly1 Antibody Reactive (LYAR) Antibody

20-abx014333
  • EUR 376.80
  • EUR 117.60
  • EUR 477.60
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

Ly1 Antibody Reactive (LYAR) Antibody

20-abx008109
  • EUR 360.00
  • EUR 526.80
  • EUR 226.80
  • 100 ul
  • 200 ul
  • 30 ul

Ly1 Antibody Reactive (LYAR) Antibody

abx033330-400ul 400 ul
EUR 627.6

Ly1 Antibody Reactive (LYAR) Antibody

abx033330-80l 80 µl
EUR 343.2

Anti-Glycolipid Antibody (AGA) Antibody

abx036399-100ug 100 ug
EUR 469.2

Anti-Glycolipid Antibody (AGA) Antibody

abx230204-100ug 100 ug
EUR 577.2

Anti-Glycoprotein Antibody (GP) Antibody

20-abx319900
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Anti-Glycoprotein Antibody (GP) Antibody

20-abx319901
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Anti-Glycoprotein Antibody (GP) Antibody

20-abx319905
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Anti-Glycoprotein Antibody (GP) Antibody

20-abx319913
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Ly1 Antibody Reactive (LYAR) Antibody

20-abx311665
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Ly1 Antibody Reactive (LYAR) Antibody

20-abx324434
  • EUR 376.80
  • EUR 292.80
  • 100 ug
  • 50 ug

Ly1 Antibody Reactive (LYAR) Antibody

abx234901-100ug 100 ug
EUR 661.2

Anti-Anti-SEPT6 antibody antibody

STJ11100949 100 µl
EUR 332.4
Description: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined.

Anti-Anti-SEPT9 Antibody antibody

STJ111369 100 µl
EUR 332.4
Description: This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

Anti-Anti-SEPT11 Antibody antibody

STJ111530 100 µl
EUR 332.4

Anti-Anti-SEPT4 Antibody antibody

STJ112276 100 µl
EUR 332.4
Description: This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer.

Anti-Anti-MARCH9 Antibody antibody

STJ112609 100 µl
EUR 332.4

Anti-Anti-SEPT2 Antibody antibody

STJ25475 100 µl
EUR 332.4

Anti-Anti-SEPT5 Antibody antibody

STJ25477 100 µl
EUR 332.4
Description: This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is mapped to 22q11, the region frequently deleted in DiGeorge and velocardiofacial syndromes. A translocation involving the MLL gene and this gene has also been reported in patients with acute myeloid leukemia. Alternative splicing results in multiple transcript variants. The presence of a non-consensus polyA signal (AACAAT) in this gene also results in read-through transcription into the downstream neighboring gene (GP1BB; platelet glycoprotein Ib), whereby larger, non-coding transcripts are produced.

Anti-Anti-SEPT8 Antibody antibody

STJ25479 100 µl
EUR 332.4
Description: This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Anti-Anti-SEPT2 Antibody antibody

STJ28365 100 µl
EUR 332.4

 

Leave a Comment

Adresa ta de email nu va fi publicată. Câmpurile obligatorii sunt marcate cu *