Produse anticorp anti-NHS

Anticorpii anti-NHS sunt oferiți de un număr de furnizori. Această genă țintă codifică proteina „regulator de remodelare a actinei NHS” la om și poate fi cunoscută și sub denumirea de CTRCT40, CXN, SCML1, proteina sindromului Nance-Horan și sindromul Nance-Horan (cataracta congenitală și anomalii dentare). Structural, proteina este raportată a avea o masă de 179,1 kilodaltoni. Pe baza denumirii genei, pot fi găsiți, de asemenea, ortologi canini, porcini, maimuțe, șoareci și șobolani.

Descrierea proteinei de legare a ADN-ului H-NS (hns)

Numele produsului Proteina de legare a ADN-ului H-NS (hns)
ID-ul Uniprot P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Sistem de expresie Expresie procariotică
Secvenţă MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKDDFL
Greutate moleculară 17,63kDa
Puritate estimată 40% prin SDS-PAGE
Tampon 20 mM Tris HCI, pH 8,0, 2 mM MgCl2 și 20 mM NaCI
Conditii de livrare Gheață albastră (+ 4 °)
Termen de livrare în zile lucrătoare Europa: 5-7 zile lucrătoare
SUA și Canada: 7-10 zile lucrătoare
Restul lumii: 5-12 zile lucrătoare
Starea de depozitare 4 ° C pe termen scurt (1 săptămână), -20 ° C sau -80 ° C pe termen lung (evita ciclurile de îngheț / decongelare; adăugarea de 20-40% glicerol îmbunătățește crioprotecția)
Marca ProteoGenix
Specii gazdă Escherichia coli (E.coli)
Tipul fragmentului Met12-Gln156
Aliasuri / Sinonime Proteina de legare a ADN-ului H-NS, proteina asemănătoare histonei HLP-II, Proteina B1, Proteina H1
Referinţă PX-P4380
Notă Doar pentru cercetare

Profiluri de legare diferențiale ale StpA în  celule mutante de tip sălbatic și  hns : o analiză comparativă a partenerilor cooperativi prin analiza imunoprecipitării-microarray a cromatinei

ABSTRACT

Am efectuat analize de imunoprecipitare a cromatinei-microarray pentru a investiga diferențele în funcție între StpA și H-NS în   celulele Escherichia coli . Regiunile de legare StpA se suprapun în esență cu cele ale H-NS în celulele de tip sălbatic, în timp ce acestea sunt reduse la o treime în   mutantul hns .

hns Antibody

CAC11910-100ul 100ul
EUR 314

hns Antibody

CAC11910-50ul 50ul
EUR 199.2

DNA-binding protein H-NS (hns) Antibody

abx345716-100g 100 µg Ask for price

DNA-binding protein H-NS (hns) Antibody

abx345716-20g 20 µg
EUR 250

DNA-binding protein H-NS (hns) Antibody

abx345716-50g 50 µg
EUR 350

DNA-binding protein H-NS (hns) Antibody

abx345720-100g 100 µg Ask for price

DNA-binding protein H-NS (hns) Antibody

abx345720-20g 20 µg
EUR 250

DNA-binding protein H-NS (hns) Antibody

abx345720-50g 50 µg
EUR 350

DNA-binding protein H-NS (hns) Antibody

abx345724-100l 100 µl
EUR 350

DNA-binding protein H-NS (hns) Antibody

abx345724-50l 50 µl
EUR 250

DNA-binding protein H-NS (hns) Antibody

abx345725-100l 100 µl
EUR 350

DNA-binding protein H-NS (hns) Antibody

abx345725-50l 50 µl
EUR 250

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345717-100g 100 µg Ask for price

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345717-20g 20 µg
EUR 250

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345717-50g 50 µg
EUR 350

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345721-100g 100 µg Ask for price

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345721-20g 20 µg
EUR 250

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345721-50g 50 µg
EUR 350

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345726-100l 100 µl
EUR 350

DNA-binding protein H-NS (hns) Antibody (HRP)

abx345726-50l 50 µl
EUR 250

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345718-100g 100 µg Ask for price

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345718-20g 20 µg
EUR 250

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345718-50g 50 µg
EUR 350

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345722-100g 100 µg Ask for price

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345722-20g 20 µg
EUR 250

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345722-50g 50 µg
EUR 350

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345727-100g 100 µg Ask for price

DNA-binding protein H-NS (hns) Antibody (FITC)

abx345727-20g 20 µg
EUR 250

 

Leave a Comment

Adresa ta de email nu va fi publicată. Câmpurile obligatorii sunt marcate cu *