Produse anticorp anti-NHS

Anticorpii anti-NHS sunt oferiți de un număr de furnizori. Această genă țintă codifică proteina „regulator de remodelare a actinei NHS” la om și poate fi cunoscută și sub denumirea de CTRCT40, CXN, SCML1, proteina sindromului Nance-Horan și sindromul Nance-Horan (cataracta congenitală și anomalii dentare). Structural, proteina este raportată a avea o masă de 179,1 kilodaltoni. Pe baza denumirii genei, pot fi găsiți, de asemenea, ortologi canini, porcini, maimuțe, șoareci și șobolani.

Descrierea proteinei de legare a ADN-ului H-NS (hns)

Numele produsului Proteina de legare a ADN-ului H-NS (hns)
ID-ul Uniprot P0ACF9
Uniprot link https://www.uniprot.org/uniprot/P0ACF9
Sistem de expresie Expresie procariotică
Secvenţă MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKDDFL
Greutate moleculară 17,63kDa
Puritate estimată 40% prin SDS-PAGE
Tampon 20 mM Tris HCI, pH 8,0, 2 mM MgCl2 și 20 mM NaCI
Conditii de livrare Gheață albastră (+ 4 °)
Termen de livrare în zile lucrătoare Europa: 5-7 zile lucrătoare
SUA și Canada: 7-10 zile lucrătoare
Restul lumii: 5-12 zile lucrătoare
Starea de depozitare 4 ° C pe termen scurt (1 săptămână), -20 ° C sau -80 ° C pe termen lung (evita ciclurile de îngheț / decongelare; adăugarea de 20-40% glicerol îmbunătățește crioprotecția)
Marca ProteoGenix
Specii gazdă Escherichia coli (E.coli)
Tipul fragmentului Met12-Gln156
Aliasuri / Sinonime Proteina de legare a ADN-ului H-NS, proteina asemănătoare histonei HLP-II, Proteina B1, Proteina H1
Referinţă PX-P4380
Notă Doar pentru cercetare

Profiluri de legare diferențiale ale StpA în  celule mutante de tip sălbatic și  hns : o analiză comparativă a partenerilor cooperativi prin analiza imunoprecipitării-microarray a cromatinei

ABSTRACT

Am efectuat analize de imunoprecipitare a cromatinei-microarray pentru a investiga diferențele în funcție între StpA și H-NS în   celulele Escherichia coli . Regiunile de legare StpA se suprapun în esență cu cele ale H-NS în celulele de tip sălbatic, în timp ce acestea sunt reduse la o treime în   mutantul hns .

anti- Antibody^Polyclonal antibody control antibody

LSMab09882 100 ug
EUR 525.6

ARHGDIA Antibody / RHOGDI Antibody

F54788-0.08ML 0.08 ml
EUR 140.25
Description: ARHGDIA regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

ARHGDIA Antibody / RHOGDI Antibody

F54788-0.4ML 0.4 ml
EUR 322.15
Description: ARHGDIA regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

CLCN5 Antibody / CIC-5 antibody

RQ6462 100ug
EUR 356.15
Description: The CLCN5 gene encodes the chloride channel Cl-/H+ exchanger ClC-5. This gene encodes a member of the ClC family of chloride ion channels and ion transporters. The encoded protein is primarily localized to endosomal membranes and may function to facilitate albumin uptake by the renal proximal tubule. Mutations in this gene have been found in Dent disease and renal tubular disorders complicated by nephrolithiasis. Alternatively spliced transcript variants have been found for this gene.

Anti-Anti-SEPT5 Antibody antibody

STJ114819 100 µl
EUR 332.4
Description: This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is mapped to 22q11, the region frequently deleted in DiGeorge and velocardiofacial syndromes. A translocation involving the MLL gene and this gene has also been reported in patients with acute myeloid leukemia. Alternative splicing results in multiple transcript variants. The presence of a non-consensus polyA signal (AACAAT) in this gene also results in read-through transcription into the downstream neighboring gene (GP1BB; platelet glycoprotein Ib), whereby larger, non-coding transcripts are produced.

Anti-Anti-SEPT7 Antibody antibody

STJ116214 100 µl
EUR 332.4
Description: This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. This human protein functions in gliomagenesis and in the suppression of glioma cell growth, and it is required for the association of centromere-associated protein E with the kinetochore. Alternative splicing results in multiple transcript variants. Several related pseudogenes have been identified on chromosomes 5, 7, 9, 10, 11, 14, 17 and 19.

Anti-Anti-SEPT8 Antibody antibody

STJ117206 100 µl
EUR 332.4
Description: This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Anti-Anti-SEPT3 Antibody antibody

STJ118990 100 µl
EUR 332.4

Anti-Anti-SEPT1 antibody antibody

STJ119580 100 µl
EUR 332.4
Description: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. Alternatively spliced transcript variants have been found but the full-length nature of these variants has not been determined. [provided by RefSeq, Dec 2012]

Anti-Anti-SEPT6 antibody antibody

STJ11100949 100 µl
EUR 332.4
Description: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined.

Anti-Anti-SEPT9 Antibody antibody

STJ111369 100 µl
EUR 332.4
Description: This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

Anti-Anti-SEPT4 Antibody antibody

STJ112276 100 µl
EUR 332.4
Description: This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer.

Anti-Anti-SEPT2 Antibody antibody

STJ25475 100 µl
EUR 332.4

Anti-Anti-SEPT5 Antibody antibody

STJ25477 100 µl
EUR 332.4
Description: This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is mapped to 22q11, the region frequently deleted in DiGeorge and velocardiofacial syndromes. A translocation involving the MLL gene and this gene has also been reported in patients with acute myeloid leukemia. Alternative splicing results in multiple transcript variants. The presence of a non-consensus polyA signal (AACAAT) in this gene also results in read-through transcription into the downstream neighboring gene (GP1BB; platelet glycoprotein Ib), whereby larger, non-coding transcripts are produced.

Anti-Anti-SEPT8 Antibody antibody

STJ25479 100 µl
EUR 332.4
Description: This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Anti-Anti-SEPT2 Antibody antibody

STJ28365 100 µl
EUR 332.4

Anti-Anti-SEPT7 Antibody antibody

STJ28963 100 µl
EUR 332.4
Description: This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. This human protein functions in gliomagenesis and in the suppression of glioma cell growth, and it is required for the association of centromere-associated protein E with the kinetochore. Alternative splicing results in multiple transcript variants. Several related pseudogenes have been identified on chromosomes 5, 7, 9, 10, 11, 14, 17 and 19.

Ly1 Antibody Reactive (LYAR) Antibody

abx234901-100ug 100 ug
EUR 661.2

Ly1 Antibody Reactive (LYAR) Antibody

20-abx311665
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Ly1 Antibody Reactive (LYAR) Antibody

20-abx324434
  • EUR 376.80
  • EUR 292.80
  • 100 ug
  • 50 ug

Ly1 Antibody Reactive (LYAR) Antibody

20-abx014333
  • EUR 376.80
  • EUR 117.60
  • EUR 477.60
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

Ly1 Antibody Reactive (LYAR) Antibody

20-abx008109
  • EUR 360.00
  • EUR 526.80
  • EUR 226.80
  • 100 ul
  • 200 ul
  • 30 ul

Ly1 Antibody Reactive (LYAR) Antibody

20-abx123734
  • EUR 493.20
  • EUR 710.40
  • 100 ul
  • 200 ul

Ly1 Antibody Reactive (LYAR) Antibody

abx033330-400ul 400 ul
EUR 627.6

Ly1 Antibody Reactive (LYAR) Antibody

abx033330-80l 80 µl
EUR 343.2

Anti-Anti-SEPT11 Antibody antibody

STJ113941 100 µl
EUR 332.4

Anti-Anti-SEPT11 Antibody antibody

STJ114081 100 µl
EUR 332.4

Anti-Anti-MARCH8 Antibody antibody

STJ114828 100 µl
EUR 332.4

 

Leave a Comment

Adresa ta de email nu va fi publicată. Câmpurile obligatorii sunt marcate cu *